PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1196s0040.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 269aa    MW: 30205.7 Da    PI: 6.6769
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1196s0040.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM43.11.3e-1364688128
                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               k v+  ++e++g+kk Lvfy+g+ pkg+ktdW+mheyrl
  SapurV1A.1196s0040.2.p   6 APKGVVIGGQENIGVKKALVFYRGKPPKGVKTDWIMHEYRL 46 
                             556677779999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100522.099178IPR003441NAC domain
SuperFamilySSF1019414.32E-181078IPR003441NAC domain
PfamPF023651.8E-51646IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MASTMAPKGV VIGGQENIGV KKALVFYRGK PPKGVKTDWI MHEYRLAETP TYTNNRSTKP  60
KDSSMRLDDW VLCRIYKKSL ALTSSPRALI SSEHGQEEEE EEQRFVEETL LPISSKNTLM  120
PQKSCSFSNL FDATDYSMLR SFLADTQFNP AGFESNPSLN GSTAQLDQTF FGNSDSASNS  180
NSTSSDYFLQ KLPQLNNSTP NYMHENKLKR QLSHLDEEMP LPSKKYANSC SFTNTSNNNQ  240
TDMGQYSFLS QQFLNQQLLL SPHLQFTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-181678112165NO APICAL MERISTEM PROTEIN
1ut4_B5e-181678112165NO APICAL MERISTEM PROTEIN
1ut7_A5e-181678112165NO APICAL MERISTEM PROTEIN
1ut7_B5e-181678112165NO APICAL MERISTEM PROTEIN
3swm_A6e-181678115168NAC domain-containing protein 19
3swm_B6e-181678115168NAC domain-containing protein 19
3swm_C6e-181678115168NAC domain-containing protein 19
3swm_D6e-181678115168NAC domain-containing protein 19
3swp_A6e-181678115168NAC domain-containing protein 19
3swp_B6e-181678115168NAC domain-containing protein 19
3swp_C6e-181678115168NAC domain-containing protein 19
3swp_D6e-181678115168NAC domain-containing protein 19
4dul_A5e-181678112165NAC domain-containing protein 19
4dul_B5e-181678112165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2167717e-53AC216771.1 Populus trichocarpa clone POP051-N07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319143.21e-122hypothetical protein POPTR_0013s05080g
TrEMBLB9I5U71e-122B9I5U7_POPTR; Uncharacterized protein
STRINGPOPTR_0013s05080.11e-121(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.13e-37NAC domain containing protein 47